DPCstruct | MC19489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 418 ± 75 aa |
| Standard deviation of domain lengths | 74.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 82.86 |
| Assigned Pfam label(s) | PF09371- CL0580- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JIH7 | 7-342 | ASVTKIAPHNILALFRGETEKIISLSIDFDETYITAYLYNEEIKTKNKGIKAFYQSMLKDSFNRLIKPSLLREVRADRKNWADLESI… |
| A0A158P8P8 | 73-489 | HVPFHFVQMARNVLSILFNCFCIMMKYYFSEMGLEEVARDILEGKCVSLYMLIGYSKGLICGLKIVEENTANAMADLLNKMPETVEA… |
| A0A183M6P2 | 6-442 | None |
| A0A836AMA8 | 267-632 | None |
| A0A0K2RFY3 | 24-333 | None |
| A0A812ISK1 | 72-567 | None |
| A0A821X720 | 452-917 | None |
| A0A1R3I0C1 | 31-399 | None |
| A0A183TI51 | 2-357 | None |
| W7UB84 | 401-832 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.