DPCstruct | MC19487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 178 ± 30 aa |
| Standard deviation of domain lengths | 30.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P8YEJ8 | 41-244 | MMHSQNFQEIFSTTINFLVERIYKNQSLQVIANSFLANPTTSPLFATVLVEYLLDKMEDMGSNLDRSNLYLRLFKLVFGSVSLFPVE… |
| A0A0K0DLK3 | 2-185 | QLACNAFLVRADVSFRFGCIIVKYLMDRLPSLAVMNDVSALYVKLFKIIFSAIGCQNSASPDGEIMLKPYLPELIRKSMEYALCARD… |
| A0A183RDH3 | 2-149 | None |
| A0A4U8UST7 | 91-298 | None |
| A0A6P8H9X7 | 686-889 | None |
| A0A5S6Q687 | 237-442 | None |
| A0A5S6Q614 | 4-143 | None |
| A0A0R3QNV0 | 481-687 | None |
| A0A183WD66 | 93-242 | None |
| A0A821EMM9 | 33-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.