DPCstruct | MC19480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 17.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1EG95 | 1-83 | MKVSSSKALELGEQFLGKGYKELVHGSSRYVSADVTRVFRMGVSDITGAHGGGPHVNFETLIPNPAKPSKMMVDNNLHIYLTD |
| A0A0A7ML37 | 13-129 | KEQLIQENLSNIAKQRPELTHAAIGEGNLTEKGTFTRAEIEKLAKEWIGEGAILNTDGGFTSADGSRKYRPPQLKNHSKYAPTGIQA… |
| A0A6M8T4X2 | 152-278 | None |
| A0A7H1APM4 | 2-128 | None |
| A0A6B2FM22 | 3-108 | None |
| A0A2W6AMY1 | 61-174 | None |
| A0A5E4X2Q3 | 110-215 | None |
| A0A6G3IK99 | 55-157 | None |
| C5B929 | 102-209 | None |
| D6YTU5 | 30-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.