DPCstruct | MC1948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 310 ± 20 aa |
| Standard deviation of domain lengths | 20.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8BMX3 | 13-334 | SSSSIAALPIRTYKASDLPLPSATRGAIEQLATAFKKKGGYDDIRKQVWESFQASDYEAQVTKSILEVAECELERNPSQLLSIGPSK… |
| C6H963 | 1-281 | MAGTEMEMAGVKRPGIDIESLKRKKFKASDLPLSAAQRTSIDSLLYAFKKKGGFDSVRKKIWAEFSESEAKNSLISSLVEMAESEID… |
| U7PTU2 | 31-336 | None |
| A0A4V1X5P9 | 12-345 | None |
| A0A0G2I914 | 1-311 | None |
| S3D619 | 18-298 | None |
| A0A4S9DCZ7 | 15-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.