DPCstruct | MC19476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 228 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267HAL3 | 250-481 | LLQCSIIVSGNYNFFNLLTICLCLSLLHDDDFSTRKGPRRAAGLKLLEWGISATLFVGLFYLTVRLFNLSVGPGFRVNSKVAFSMND… |
| A0A023GGY2 | 2-236 | FLQLMIIVTGNYNFFNLLTMTLCLSLVDDDFLLGIQRRSGKPGKLRTLANVAARTIALAVYCGLFYGTVKLFHLRFDNNWALHSKIG… |
| F1L4I2 | 17-249 | None |
| A0A218UBD8 | 254-475 | None |
| A0A6P8H9A7 | 4-209 | None |
| A0A654HRP7 | 608-839 | None |
| A0A6L5DMC9 | 4-193 | None |
| A0A4S2M9V9 | 252-438 | None |
| A0A7R8VW95 | 7-282 | None |
| A0A418F5S5 | 208-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.