DPCstruct | MC19475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 223 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6LX57 | 94-309 | NEGNAKDTEYAVALVWLRHVLCGLRHFGQDLHASTTDSDLNLLYEVVSKVETDSGGVIDVYRAASLQQFRRAAEVLNILAQRTRVIR… |
| A0A2G8K3V0 | 136-380 | TQGLVQTIHGYLFIRPRLKQIEPALLQRDIKDVLTESYHCAAELFNDSIQWMESGVDARLTGAHLTLSKIHQDTISGTIKGHHVMHA… |
| A0A0K0D1D0 | 398-609 | None |
| A0A2V2W3Q2 | 1-220 | None |
| A0A2D4C0F3 | 354-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.