DPCstruct | MC19472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 282 |
|---|---|
| Mean domain length (aa) | 181 ± 37 aa |
| Standard deviation of domain lengths | 37.05 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 98.26 |
| Assigned Pfam label(s) | CL0126- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1V9S1 | 3-147 | LPDVMVLARALMEEHGVGHWGLELDRARRRAGQTDDARRRITLSRHLMALYPESEVRETVLHEIAHARVGAGHGHDAVWSAEARRIG… |
| A0A0V0V6H6 | 63-254 | IPHVINGNTNPAVAVQRMMDQKLLKSNKKMELTRELFSVFNEHVFNNRLPKDMEICFNRRLYKTAGYCRCKLNRFTKLPYCIIELSE… |
| A0A838QCQ9 | 67-173 | None |
| R1C0X4 | 36-191 | None |
| A0A1N7CHX2 | 9-143 | None |
| A0A136QAL0 | 2-133 | None |
| A0A1I5IYT6 | 5-136 | None |
| A0A1I5IY10 | 4-118 | None |
| A0A2V7WKY5 | 10-162 | None |
| A0A523HVA6 | 118-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.