DPCstruct | MC19470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9JZF7 | 138-246 | ELFQIACNNLKKFGFDINGLIKKDASLVTWELDDYNYFFIQNSFEGKTFDKVIQNIQESHDRKKREIVLIYAGTFCHVNVKKNSNFK… |
| A0A7V9M1P2 | 1-97 | QLQFPEKVFNVVHINALDYKIEDDMNVFFFFNPFDEIVMKEVIKKMLASINKNKRIIHVTYINPRHKQLFINAGFTEVFYIKKMNYA… |
| A0A7W0PXJ8 | 118-207 | None |
| A0A2A4TG38 | 59-138 | None |
| A0A7X9H0L2 | 1-95 | None |
| A0A523EPY5 | 657-737 | None |
| A0A1C5N2K1 | 1-116 | None |
| A0A0R3KHA2 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.