DPCstruct | MC1947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 192 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811W5T6 | 1-182 | MANFSRRGASYSALNNEETPPLGHLRDSINAAPTIITLDQDNEDSNVVIHKVPQTKGGWTHIEDLDSFFTRMYRYYLRGGFYPMIIS… |
| A0A0L0DP86 | 35-216 | LLGSGEGGQGPSPFANIASPDGFLKQTYLYYVGLGYWPIVTQQVFDLLTLAFVIFLFGFVTMAVEYGRLLDDLSAENRIAFVDYMSF… |
| D3BQ47 | 19-202 | None |
| A0A8B6CCD6 | 5-191 | None |
| W7TMH9 | 102-312 | None |
| U4U256 | 1-182 | None |
| A0A1Q9CYE7 | 1-175 | None |
| A0A2V5J7X2 | 3-198 | None |
| A0A7E4SFR4 | 2-191 | None |
| A0A7M5V6W0 | 2-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.