DPCstruct | MC19462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6WDJ2 | 355-465 | AATPGCRPAHAAHPDVRAALEALTNLRLARLQDDTETHRTADEIDASVTGLMVEPRGRGRVAAYWMVEGMHTTPEGEAHRAQLDIIR… |
| A0A1C5DIZ0 | 41-188 | AALARRAGHLWEGGAESTEGSRGAFVGCLPEHAGHPAVRAALAQARSAGVPLAVIGRDWRWGYGEHGAFGLFVVPTGERTVECEWFI… |
| A0A7Y5XZK0 | 16-146 | None |
| A0A1E5NXP9 | 1-128 | None |
| A0A2P7PVS6 | 154-304 | None |
| A0A101RL18 | 2-133 | None |
| G2G5R9 | 101-226 | None |
| A0A1H5M2S2 | 131-280 | None |
| A0A209B3F1 | 2-120 | None |
| A0A7W7PWQ7 | 210-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.