DPCstruct | MC19460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0F5D3 | 38-101 | DVRHRALRHHSEGIFLCEAIFGATLTNSVGKVVPVRTIGEQHVKDDLGWIPTVKDWLQHLEVQP |
| L0NMB9 | 1-73 | MFHHSAGIWLSEAIFGTTITLSTGRIIPTRWVGEQHVREDLGFIPSFTDWVKTIRPEPWMGRAEKIEALVDPH |
| A0A1V0PYC6 | 45-126 | None |
| A0A4P9WST2 | 189-272 | None |
| A0A7C5REP4 | 86-167 | None |
| A0A420G994 | 101-167 | None |
| A0A2D6BEC2 | 40-130 | None |
| A0A0N8KF28 | 212-287 | None |
| A0A7X5JEK0 | 38-135 | None |
| A0A2D6Q2T7 | 44-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.