DPCstruct | MC19456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 68.59 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0092- PF04815- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183Q1P1 | 237-303 | ARMAMFKAETTDSVDVLRWLDRQLIKLCHKFGDYRKDDPTSFRLPGEFSFYPQFMFHMRRSQFLQVF |
| A0A067QG97 | 12-68 | GDGPDVLRWADYMLIKLCQKFGEYTKDDPNSFRLPENFTLYPQFMYHLRQVTFSQKF |
| A0A7R9PUE4 | 939-1003 | None |
| A0A2G2WXD5 | 213-276 | None |
| A0A183X1V8 | 1-59 | None |
| J3N7Y7 | 401-465 | None |
| A0A0D0A2T6 | 101-178 | None |
| A0A6A3CYD6 | 12-66 | None |
| A0A067JQ04 | 542-606 | None |
| A0A368G6H5 | 314-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.