DPCstruct | MC19454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146HE19 | 58-145 | ALFRIPRPWEMQRPKFTTDDIDELVDFFEQVDTIIELGGISDEQERKQLLTSYLPVNKRILWRSLDTYQRSCSLKEFVTEIRRMYPEL |
| A0A2G8SJ48 | 1-101 | MAQAAKQTMPVRGEKTCPKFDEADPTSLHRYFDDLEALFVRHSMPDADQDDWKVRKELAVRYPPAAVEYGWKSLPEFTEVTKNYTDF… |
| B8PMQ8 | 5-95 | None |
| A0A2H3BMW0 | 2-86 | None |
| A0A0C3AII1 | 1-81 | None |
| B0DE29 | 15-104 | None |
| A0A2H3CG60 | 1-84 | None |
| A0A2H3CL68 | 5-97 | None |
| A0A2H3CPQ6 | 3-90 | None |
| A0A4S4LZF1 | 113-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.