DPCstruct | MC19453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 168 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J8Q746 | 12-145 | TAAPDYSETSQRLAKLIAEAMTCGFALLHYDSASKSMIEWCWPTDGDGKKILPSGLEKYHDEYNFRYPCCICADGGGRGAYVEAAVY… |
| A0A2G8SHA7 | 1-169 | METAELHLLLIETVTNERECVLQFDGERLALRSWLWPQERSGALIAPENLREYRSSHNFLGPGCFCPALSSMTTPGFVEAAILQRGN… |
| A0A0C9USH7 | 39-194 | None |
| A0A0C9TJN3 | 32-218 | None |
| A0A0C9TLS0 | 32-224 | None |
| A0A0C9UI97 | 13-226 | None |
| A0A4Y7U0V5 | 2-183 | None |
| A0A1B7MHP4 | 1-175 | None |
| A0A5B1QNJ7 | 108-258 | None |
| A0A0C3EV26 | 56-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.