DPCstruct | MC19451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A480ADU8 | 1-80 | MSTMQRESELLLKINQGIPLDIQKSYNNLIAKRDVKTLSNDEYKELLRLTEQIEKQQAQRIEYLAELASLKGISLNTLME |
| K9UKR5 | 33-119 | KVNSKESDLLKEINLGVSTDTWTKYHTLIAKRQAEIMTEEEQQQLIEISDRLELANVRRMKALIELSDLRGQSLSTVMQDLGISEFH |
| A0A7V4YWS4 | 49-123 | None |
| F4KQ89 | 2-88 | None |
| A0A433URT0 | 230-307 | None |
| A0A7X3ZPS0 | 54-137 | None |
| A0A136PHZ6 | 74-149 | None |
| A0A258AMG1 | 13-97 | None |
| A0A831T1P4 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.