DPCstruct | MC19448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9UC79 | 1-122 | MLVDLEQFIEAPALPEYEREYHLTVVREQSKAEILAAISESEEIDPEVAYQQAMALAHDENVSEWGAAISVGLDEWDNESVPLLELQ… |
| A0A7Y5I9X9 | 10-150 | PIMADDAFDRYVRQSMVVDFDQFIEPLPSLPRKNPEQTKHGNSMVGAIDKEVLIQALEQESLLSVEEEFERAISTAHAEDVSSWIEA… |
| A0A2T1CEV7 | 62-194 | None |
| A0A433W7X5 | 48-207 | None |
| A0A7T5E820 | 91-202 | None |
| U9VZA1 | 1-134 | None |
| A0A0S3UE57 | 84-223 | None |
| A0A2W7A819 | 313-459 | None |
| A0A2W7A330 | 79-228 | None |
| A0A2T1CCJ3 | 50-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.