DPCstruct | MC19446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A364Y687 | 4-113 | RTYTPVWHKYRPAILKMMIESTTEPQSYQLSNHEFKALNPKQKGGYAFSLQVSGGKAVSGLKNSVVAQDLWEILQLSPKAIEMIATS… |
| A0A1M7RIJ0 | 1-102 | MGSQHLYTDIWRKEFQDILALTEFFPSSGKQLSAADFEAVGNRKRYAFRLEIADGMVVNNIDGSAVARDLAEVLLASEQVRSISTGK… |
| A0A1W2G4W6 | 10-112 | None |
| A0A3D6ER10 | 4-87 | None |
| A0A7J0AQ37 | 63-165 | None |
| A0A1M3DKB9 | 204-312 | None |
| A0A1M7N0M2 | 31-138 | None |
| N0BGD2 | 4-104 | None |
| A0A1N6KA91 | 2-103 | None |
| B2A7U9 | 3-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.