DPCstruct | MC19443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.64 |
| Pfam Score | 46.97 |
| Assigned Pfam label(s) | PF10898- PF11163- PF20541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7DP77 | 43-213 | LTSEEYESKWEIVLKSIFINRNTALPNLVFSKNFDLLVLEGGCLFVEEDFKKLQECILNVGDEFLFIIENDFGGRLKEPTFRMRFPS… |
| A0A7Y9CSU5 | 6-148 | VILSDNKTAIIRKKIEEELYKTFKSGSSTYWFPLKDIKDNIPVIAFNSDYWDDDYKMQSLLNLMKCHNIKKAYTLQENSNVYVYDDY… |
| A0A7U6Y455 | 2-180 | None |
| A0A5C4T5C7 | 113-262 | None |
| A0A518HMH5 | 36-189 | None |
| A0A1Y6BKP5 | 5-149 | None |
| A0A849WTH8 | 259-374 | None |
| B9XID1 | 3-150 | None |
| A0A3D1PFL4 | 2-162 | None |
| A0A1G6I7V1 | 28-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.