DPCstruct | MC19440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9D8E1 | 15-104 | IYGNGLWSMMYAFVALGTDGRTIKGLTYYDHGETPGLGGEVENPNWRQQFIGKQVLDDSGHPALKVVKGGRTRRYPCRRRPVRGDAD… |
| A0A381UKH5 | 70-139 | NVEGYAIPIAGKGLWSTLFGYFAIEPDGRTVKGITFYKHGETPGLGGEVDKAWFQQNFIGKRFVDENDQL |
| A0A3T1DS93 | 129-213 | None |
| A0A2E4KC33 | 137-224 | None |
| A0A2B4R895 | 387-463 | None |
| A0A2H0EQW8 | 72-150 | None |
| F2AZA8 | 1-88 | None |
| A0A0E2IYT0 | 151-213 | None |
| A0A848VCP7 | 51-133 | None |
| A0A7C5CQ88 | 140-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.