DPCstruct | MC19439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 251 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 22.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 99.63 |
| Assigned Pfam label(s) | CL0229- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1HZ82 | 73-196 | VEQCIRCIEDTTSVSKAEEEEELKMHLRDVGLSSIRVSLQCPVTQIRMAVPGKGMYCMHIQPFDLRQFLLRNLLEHDRLQGNCPECG… |
| A0A443SGJ0 | 30-162 | ENTWDIIHKKKAKFETEIEDTKWIVSLVCPISKTRMRMPCRSSKCDHIQCFDREVFLSIAKKQNHWKCPLCLKPLATSDLRIDTLLE… |
| M1W4L5 | 544-704 | None |
| A0A0D2HWV7 | 423-565 | None |
| A0A2H2ZML7 | 162-304 | None |
| J6F260 | 105-263 | None |
| A0A7R8XAG2 | 550-706 | None |
| A0A034V7J9 | 161-308 | None |
| B0ETL3 | 280-447 | None |
| A0A4Y7JJ41 | 3-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.