DPCstruct | MC19438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 2.67 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 42.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443SFT2 | 1-72 | MKAKIEDIHRAVTFGKLRNVQQLIDRKKLAFCRDQMGATPLHKAVIYGQTEIIHYLLDKFPSVIHSRDHQCT |
| A0A2G5S960 | 97-169 | DRLPEYMEKIDGIHRAIKEGNLDEVKELMKTKKLAIARDRYGCTPLHSAVVHEHTDIVRYIAGHYNSVLNAPD |
| A0A6V7VWG9 | 72-137 | None |
| A0A1I7W721 | 307-376 | None |
| A0A5B7I9Z2 | 6-75 | None |
| T1L684 | 47-115 | None |
| A0A5S6Q313 | 63-137 | None |
| A0A0D6LQ70 | 81-150 | None |
| A0A1I7T976 | 80-147 | None |
| A0A0M3JLM4 | 49-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.