DPCstruct | MC19437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 7.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q16ZN0 | 1-61 | MSDSVDPVEQMLLKTGCINLHYKVQECIAETGDWRKCQDVVKDFKTCMQDYTEKQRQKYEK |
| A0A443SDW3 | 1-68 | MSSKAHSYTVSENEDDPFEKAIKSTGCYDKHVQLQDCMFEHRDWRVCQPHVKQFKECMATYQLNKNKN |
| A0A5N4DM73 | 2-65 | None |
| A0A0N0U542 | 3-69 | None |
| A0A7J6CLZ4 | 69-136 | None |
| F7E380 | 1-72 | None |
| A0A6P8RHX2 | 50-127 | None |
| T1EHP0 | 1-53 | None |
| A0A482WTG3 | 1-60 | None |
| A0A553N7U6 | 126-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.