DPCstruct | MC19436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4UEU5 | 191-264 | GETQTYNLMTSVSLPVYDKKPRQERVANLLGVAGTDVPIEYIQRLMLPHRLGVNGYGFIVTNNGYILTHPDLRP |
| A0A0S7I923 | 61-127 | TTTVAMPVFSTKNETKNQGILLGVAGTDIPLQELMKLIPKHMLGIHGYAFAITNNGYILTHPDLRPL |
| A0A1I8HU78 | 9-74 | None |
| A0A1B6C2N7 | 549-620 | None |
| A0A1I8IXK7 | 1-74 | None |
| A0A1Y3BCC3 | 1-96 | None |
| A0A673FU07 | 355-422 | None |
| A0A7R8UST1 | 56-133 | None |
| A0A7R8URQ1 | 53-133 | None |
| A0A183AEA6 | 231-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.