DPCstruct | MC19435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 135 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1WH17 | 8-144 | KRFYQLSLAINKAINSIETPVKEKHVRSTIIGTFQERSAVTYWMVAVRLPLQDNRIVAWKFCHVTHKLLREGHPACLDDSQRHIGMI… |
| A0A443SBU6 | 8-153 | TNSLEVEREYFEKCQAISVAKALNGSESPVKEKHVRRILIGTFKDQNSVLFWSIVRKLPLQENPIVCWKFCHVLHKILREGHRKSLS… |
| A0A3Q3WCC7 | 2-134 | None |
| A0A132AL20 | 16-155 | None |
| A0A4W3IDL0 | 30-161 | None |
| A0A5B7ITW6 | 1-118 | None |
| A0A504Z1K4 | 1-131 | None |
| A0A815F4M0 | 30-168 | None |
| A0A0A8L1S0 | 4-150 | None |
| A0A0V1KV38 | 24-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.