DPCstruct | MC19433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | CL0112- CL0123- PF01990 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2U836 | 2-73 | THIAAIGERLRVVGLATAGVVTFPAEDPEAVRAAWRGLPPEVGLVIVTPAAAAALGPGPLDAEDPLTAVMPP |
| A0A443S8Z7 | 233-332 | LLAVIGDEDTCVGFLLGGIGEINRTKTPQLNFMVVDKNTVTSEIEETFKGFLKRDDIDIILINQNVAELIRHAIDSHVEAVPAVLEI… |
| A0A6A4NM03 | 1-86 | None |
| A0A846NYI9 | 2-88 | None |
| A0A0R3T8N6 | 10-110 | None |
| A0A7R9B8P9 | 43-136 | None |
| A0A7J6LZ72 | 9-124 | None |
| A0A2H4SLD5 | 9-120 | None |
| B0EQN5 | 13-93 | None |
| A0A7R9UB00 | 54-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.