DPCstruct | MC19432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7ITH7 | 2-133 | DIPIFTEDFLEHNKNREKELRELRKLNYQYEEQNAILSTHVDELKKIVSSLEEEANLQRSNNIALVQHLESLRDTLASNFAKIPLPG… |
| A0A443S677 | 1-145 | MNKTPRDNRDVRDIPIFTEEFLDHNKQRETELRQLRKATTEYEEQNAILSKHIENMKSAIEKLENETSQQRNANEALHQHLIQLRSI… |
| A0A7J5ZGU0 | 1112-1264 | None |
| A0A3L8RXG2 | 183-334 | None |
| A0A2J7Q1R4 | 30-179 | None |
| A0A4Y2LRX5 | 163-315 | None |
| A0A7R9AWJ4 | 522-669 | None |
| A0A2D4P262 | 17-165 | None |
| A0A0K8W3Z1 | 155-296 | None |
| W5MGB7 | 46-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.