DPCstruct | MC19430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9QU13 | 108-251 | AIDYKLKSEAIDLSDEPYSDRAGFCGIPPALIQRYADECQRDTYEVADALDSVRMAGLLAKGRRGVPNDYLGDSCVGPVIDTANYES… |
| A0A443S2U7 | 2-127 | SGFCGIPPALVQRYAEEVNEDVYDVADAIDHLRLRSLVVRGRIGIPNDFLADSCTGIIIEQANCESLHSWLVSIGLPMCEKLFNEHG… |
| A0A4Y2CWT6 | 812-953 | None |
| A0A0R3UID5 | 47-203 | None |
| A0A6I9YT81 | 775-919 | None |
| A0A2G8LDS5 | 1007-1146 | None |
| A0A4Z2HLN7 | 337-478 | None |
| A0A7R9LHA1 | 16-162 | None |
| A0A834EGH2 | 4-142 | None |
| A0A671X113 | 948-1089 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.