DPCstruct | MC1943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3TUF3 | 59-125 | PNVPGTPEPVANTNSLTETEKAKVQKNVEDANKGNFPDGTKVDVGADGTATITYPDKSTDTIKGSDL |
| A0A7W3TUS4 | 7-87 | PSVPETDAEKITPNVPGTPEPVANTSSLTETEKAKVQKNVEDANKGNFPDGTKVDVGADGTATVTYPDKSTDTIPGSKLVR |
| A0A2I5KGA4 | 796-868 | None |
| A0A139PQT1 | 33-104 | None |
| A0A139Q750 | 215-281 | None |
| A0A139R981 | 251-311 | None |
| A0A116SCI6 | 13-79 | None |
| A0A139RNV3 | 67-143 | None |
| F0H345 | 63-152 | None |
| A0A0R1WT01 | 45-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.