DPCstruct | MC19428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 87 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443RZ33 | 1-91 | MKDKLSAAKTEFRDLLKETKIITFKSKKMIEESEQHLQDIVAILQNDKRYLILDCIEDERRHLLMAYIDELDRKGPPPPPTASEPTR… |
| A0A336N1F6 | 135-218 | DKTLLAKASFRELLSETKLITHKSFEMVKENPNHLKEIEEILKNDKRYLDLEHIHHERSSMLNNYLEDLMKRGPPPPPTATNRN |
| A0A069DXB0 | 776-865 | None |
| A0A4C1UMF8 | 355-444 | None |
| A0A2W1B7W1 | 132-220 | None |
| A0A1B0C2Z6 | 1-89 | None |
| A0A034VWB4 | 56-142 | None |
| A0A1A9XUP1 | 1-85 | None |
| A0A3Q0IUW2 | 260-348 | None |
| A0A6J1P4F4 | 122-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.