DPCstruct | MC19422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 284 ± 43 aa |
| Standard deviation of domain lengths | 42.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2DXU7 | 228-535 | RHAERQVWTGRNRGAAGAYSALAAILLVVGIVSLIAPAVLLALATTEYVGPDWRWNPAVMADHFHLWRLVPPALLAVDLLVVSAAIL… |
| A0A7C4ZL56 | 30-308 | RSAAPYTNALGLLEIFLLLNGLRLWSDKSSSVKTLSAWALIGLVWLGLLAIWGMIFGERQEQDDLTSTVAFVVMMAFAGLALYITRR… |
| A0A1C6MN38 | 140-453 | None |
| A0A3N1LAG0 | 86-462 | None |
| A0A4V2TY98 | 90-440 | None |
| A0A495W2F3 | 16-297 | None |
| A0A537HUV7 | 2-217 | None |
| A0A1E3WEG8 | 173-505 | None |
| A0A6H1LZJ2 | 4-196 | None |
| A0A6G4ATD7 | 391-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.