DPCstruct | MC1942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1EI63 | 2-86 | PNTGAFHLLSVVGKADYVDEVLEELSSVTATCRSCGAEFSATSPANGLERISGGVVLTCPKCGNRQAISEARFASFMKRLGDKQR |
| T5KWI8 | 6-78 | CQFELLDVDALQDPASGRLLHLYSLVARCLSCETIFKAEEGQGLVSHTAARVVRCPTGCGQQAFKPALLRSWH |
| A0A498CGS9 | 109-207 | None |
| A0A1E7RSV6 | 9-91 | None |
| A0A2R3Q304 | 42-108 | None |
| A0A357MYJ6 | 1-84 | None |
| A0A3D5JU05 | 4-73 | None |
| A0A7H1AH77 | 19-88 | None |
| A0A7V8FJ02 | 11-87 | None |
| A0A7V8FGB8 | 49-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.