DPCstruct | MC19416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 178 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VCM4 | 1-162 | GTHENYLMNRETPFTAVIAGLTTFFASRQVITGSGRVGIGQSGDEAGYQLSQRSDYIEVEVGLETTLKRGIINTRDEPHADPERYRR… |
| T1CLM0 | 1-213 | MLLMNWGSPLKYSLIKNNIDHQTLATFGSHENYLVSRQFPFTERGMEPLVAFLVTRQIFTGAGRVGSANLNESIITFPPTDKTVTFQ… |
| A0A2Z5QU87 | 641-851 | None |
| A0A0K8QEJ5 | 346-524 | None |
| A0A0G1M2B1 | 108-284 | None |
| A0A0S7ZQI5 | 99-275 | None |
| A0A2H0YC33 | 155-350 | None |
| M5RUF1 | 122-297 | None |
| A0A1V5PJ38 | 258-414 | None |
| A0A3M1RPR1 | 136-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.