DPCstruct | MC19415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 234 ± 47 aa |
| Standard deviation of domain lengths | 46.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8QSM2 | 20-196 | GGISVETSQLQTLQEREWFADRFEELKKEAFSPEERRMLAKLMLESQEFDHFLATKFATVKRYGGEGAESMMGFFYELFRSSVYSGV… |
| A0A0D2GIS5 | 58-335 | NVKSLVRAYETLGHLKADIDPLGQRHYWTPAPEVPDELEVQSHKLREKDLDVEIDVRSAGILPYFTQSTRSSMPVRDIIAACEQIYC… |
| A0A061RGW0 | 7-168 | None |
| A0A6I1JHU8 | 110-377 | None |
| H3BAN4 | 35-243 | None |
| A0A6J1WLZ4 | 2-181 | None |
| A0A090KZX9 | 357-611 | None |
| A4RUA4 | 85-361 | None |
| A0A2R7W2B5 | 29-231 | None |
| A0A0F3NGR1 | 72-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.