DPCstruct | MC19413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 105 ± 18 aa |
| Standard deviation of domain lengths | 18.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q38CF3 | 305-394 | LITTHHRCHFRGDSWVGLLREKPQAMQAALLKDISLELRAPYGFITIATMESVSELVVFDVIIRHPVSLSEDDVELRLIGCSFDEMS… |
| A0A1X0P7P7 | 204-297 | EESSEIMKTKHTIRFRGLKWKRILKRKRSVLEEALKKDISAATGFNEKEIFCLDIEFKVALIVTFVLQHKSDTESKEIHTLLHRYDY… |
| A0A2V2X6I9 | 32-150 | None |
| W6KWG0 | 40-128 | None |
| A0A2V2XEQ2 | 116-215 | None |
| A0A7J6XTL3 | 385-499 | None |
| A0A836HIB9 | 290-394 | None |
| A0A836HV69 | 1094-1212 | None |
| A0A2V2VF26 | 311-411 | None |
| A0A2V2VT39 | 152-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.