DPCstruct | MC19412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 276 ± 30 aa |
| Standard deviation of domain lengths | 29.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2X6I9 | 63-308 | VITTRHTKRFEGDNWKCVLENHMEALRSTFVLEAAIACHREPEDITDLEFRLGSLYVTFHVSHDADVGESEIQERVDLYPFREVLRL… |
| A0A1X0P7F9 | 254-516 | MVRTTQELGFEGEDWEYVVQQHPKEVEEAVASETARALKCEREDVTRVELDPAPQGLIAFVTVQHLPSMSEDVMRDLLRKYPFKEVW… |
| Q4Q2T8 | 2-279 | None |
| A0A7G2CQ02 | 299-561 | None |
| A0A7G2CN86 | 2-273 | None |
| A0A7G2C9E2 | 2-256 | None |
| A4IA32 | 139-474 | None |
| A0A0N1HRC1 | 293-575 | None |
| W6KWG0 | 43-311 | None |
| A0A7G2CP53 | 90-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.