DPCstruct | MC19410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2N1P4 | 37-149 | PVAMLHWPAGELAELIEAYPPLAAEYPSYEEHLASIEAALRELASSGTPNLGVVPGTVPSYEAFAASEGASPADPVLLPQYATTLAA… |
| A0A7U9K456 | 13-150 | DETPAAESAEPITAVSLAWLPAGDYERALDLWPDFAGSDLVTGPDGPVAHPLYCRRMQQKLVEFAEAGFPGLEVAAIRVAPFAAWCA… |
| A0A4V2S1W6 | 212-325 | None |
| A0A7U8UZW6 | 128-240 | None |
| A0A1Y2NI66 | 90-211 | None |
| F3ZBI1 | 406-518 | None |
| A0A6N7GFJ5 | 55-173 | None |
| A0A4Q7KIN9 | 214-330 | None |
| A0A810LQE5 | 125-245 | None |
| A0A655JME1 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.