DPCstruct | MC1941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5NFG0 | 3-78 | APMIRFIDTRYNDLFTLPDGGLITEKRFDGTTNTYQCYYLNDYHTKIGRNVFHIHEYAKRMEAIGARYFPTQPKEK |
| A0A417GPN5 | 148-226 | IRFITSDYTALFRLPDGGKIRILRQDGTHIDRVCRYIDDYHVEIGSSWDSIYHICQFAEQMERCHNTVLPLDTMENTTR |
| A0A1T4XWP5 | 158-231 | None |
| A0A1Y4F2I0 | 4-77 | None |
| A0A143XI80 | 2-80 | None |
| A0A1D9FHQ6 | 182-255 | None |
| A0A416PDF4 | 7-79 | None |
| A0A355JHH7 | 1-77 | None |
| A0A415U6I3 | 2-83 | None |
| D3AM47 | 92-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.