DPCstruct | MC19408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 26.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.30 |
| Pfam Score | 85.29 |
| Assigned Pfam label(s) | CL0063- CL0722- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7YGN1 | 3-121 | IGTVANKLFQGLPKKVVVKYYESFAETHKGHGTDFAIIAGILGLAADDSKVPDAIKIAESKGIDITFIEQLGNSPAGHPNTADVYAE… |
| A0A854ZT33 | 10-135 | IGPITIGTPSANGVEATKIGHIVRQLFLKTPEKIEISLYGAFKKTDCTFGSDVALVGGILGLEMDDSLFSKALTIATERGITVNCIE… |
| A0A7X6X771 | 14-139 | None |
| A0A6C8GK61 | 2-120 | None |
| A0A2X2E0T1 | 4-169 | None |
| A0A6G9WN51 | 3-139 | None |
| A0A7C6YL27 | 4-162 | None |
| U2WB03 | 67-240 | None |
| A0A0C3C948 | 129-255 | None |
| C2FS65 | 4-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.