DPCstruct | MC19402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5TCN4 | 5-71 | NPLLNLPAGKALLQLPAEDRARIEAVMRQLRDQANAEAENAWRRRKGPMAAYWRAVATYARHIAHAL |
| A0A2J7VDE7 | 1-86 | MAIITPSEVPRSLRPSVRNPLIELPAAREIQSLPEDTRKHLRALLLDIRASAQMKAQHSWRFSKAPMAFYWKVVAVYAGHIARLLR |
| A0A420RSI2 | 35-123 | None |
| A0A126RLX7 | 1-81 | None |
| A0A3A1P3M9 | 1-83 | None |
| A0A839W796 | 1-78 | None |
| A0A250DS88 | 868-954 | None |
| A0A808VV93 | 5-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.