DPCstruct | MC19401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 172 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0IA67 | 88-260 | WGAYLLVTEPLNFFQATGLVITIGVINSGGINLAHELGHKKNRFNQIVAQAVLMTSAYMHFFIEHNKGHHVHVATPLDPATSKKGQT… |
| A0A2J7VBB2 | 1-138 | MSFWVVASLNLTVAHELLHRPVRWQRIAARLLAGSIGYFQMLEEHRSHHLQAGGRDNGDSPEVQESVFAYAMRRYVRSFQVAQEWEH… |
| A0A3S0ES69 | 38-203 | None |
| A0A2W4IWJ3 | 125-290 | None |
| A0A1Y5RVU5 | 81-246 | None |
| D7FNV7 | 144-311 | None |
| A0A3N8CJ45 | 91-243 | None |
| Q6SQM6 | 24-191 | None |
| A0A7Y2TFV1 | 7-165 | None |
| A0A1A3L3J5 | 6-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.