DPCstruct | MC1940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 25.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417GJP7 | 182-364 | SIPGTANSGNSDGAASLPDTSLHYVPFTYAGTIEAYKLTSEMATTEEYAQQNKYPHSLFVADYVVTHTVSWDDLNTKSLIFGKNYAS… |
| A0A2G5W5L1 | 174-385 | GPLKLIAGDMQAGYFGRVPAAELFTGSELSAAVGISAGTLQHNDTDWLKFAYEGKILFRPMKTIRHSISWDHINAAGCALGTKTVSK… |
| A0A2A7MID4 | 49-251 | None |
| A0A6I2R824 | 257-497 | None |
| A0A6I2R094 | 4-169 | None |
| A0A6I2R3C4 | 13-196 | None |
| A0A6I2R4M7 | 15-153 | None |
| A0A6I2R9S5 | 28-180 | None |
| A0A418TBV6 | 182-345 | None |
| A0A1E1VFJ8 | 39-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.