DPCstruct | MC194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 417 ± 35 aa |
| Standard deviation of domain lengths | 35.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846RPI5 | 178-586 | VVVVCVALFLVLVRPAQVPWSGWPSAPTPAGTSHLDAMALWIAISISASFLAALALAAHYHAAGTQERQARVPLVAAGILLPVAVLL… |
| D9XYG4 | 20-404 | AAMRGLAGPAVAMLACALGGVMSGGVSQRVSDWLDGTGTSVPGPPVLLTWQASVIPPLLVLVLVMCGWLARRAWRIARAERAAVERE… |
| K6W8S8 | 346-820 | None |
| A0A4R2VD89 | 226-654 | None |
| A0A2W4P7R1 | 147-561 | None |
| A0A1L9NTQ2 | 9-437 | None |
| A0A2P2CFD2 | 650-1002 | None |
| A0A2A3GU09 | 488-900 | None |
| A0A2H5F2R2 | 310-709 | None |
| A0A8A7VEZ4 | 369-827 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.