DPCstruct | MC19397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF14191- PF18830- PF14195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2VYU7 | 13-123 | SLIHGMENRYGIYQLSDGRGSEYRFMGLDFVNSRGLQVKGSDYQFVYGNRLSANETLDTLFYQFNVEHPKDFRGHSLSVSDVIVLRR… |
| A0A3T0KTU0 | 2-96 | CKYEIFQVKRELTREFGYMSKDMLENEINLDNYDSVYQGEIEGNYSNIDTLLEDLFVMFNISHPDNFTGRSMSVSDVVQINDNYFYC… |
| A0A3E2YGU3 | 1-126 | None |
| A0A7W5YGE3 | 7-107 | None |
| A0A564WAB6 | 116-228 | None |
| M0MCT3 | 43-167 | None |
| A0A543FG38 | 23-127 | None |
| A0A6L5X366 | 447-550 | None |
| A0A847A7H1 | 491-607 | None |
| A0A7X3MCU4 | 13-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.