DPCstruct | MC19396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 138 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | CL0063- PF13700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J6NIX8 | 12-171 | EPPNDDYELDQLTAFSEQDFALIQQHRGSANRLGVAVLLCYLRHPGIALDEGCQPAPRLLRRVAAALGAREEDWERYATRDQTRREH… |
| A0A3Q9RJB3 | 1-125 | MKKNWNEEELLADFVLMPNELHLSMVNKTDANRLGFALLLKYFQQEAKFPSKKQEIPKVIVKYIAKQLDISPDSFDDYSWGGKEKTY… |
| A0A2N3YUI4 | 15-175 | None |
| A0A0E3B8H8 | 7-170 | None |
| A0A0M8R681 | 1-125 | None |
| A0A1S2NUI0 | 1-144 | None |
| A0A5C0E3U6 | 60-203 | None |
| A0A1T3NLY6 | 81-235 | None |
| K2GK21 | 20-160 | None |
| A0A527U5A5 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.