DPCstruct | MC19390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TG27 | 1-72 | MAEPHDWHSSPITGETRIDAHYRNTQNVRRFFRAEIGERFRFDRPFMAWMKSHAGSTMRDAVEEWLRREAGR |
| A0A2A4XUZ0 | 11-79 | TPHFDWHKITLSKDTVITNNYKNSQNIRWFFTANLGESFKFNIEFMAWIKANSGKTLGDACLQYQTMKK |
| A0A2G6GRC0 | 58-126 | None |
| A0A354X1X8 | 58-134 | None |
| A0A7S4DYQ4 | 99-180 | None |
| A0A2A2JWM6 | 55-130 | None |
| A0A2P5Z5U3 | 13-80 | None |
| A0A7W9K439 | 24-102 | None |
| A0A317PP99 | 8-85 | None |
| A0A1M7AFK8 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.