DPCstruct | MC1939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 157 ± 28 aa |
| Standard deviation of domain lengths | 27.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 43.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0Y6Q0 | 2-178 | DFEFTVIYKTSIVLISGAISNSSYHFKTVKLEGKPLLLSINQNARRLCKQEIKKVISVIKLYSKQDLQIALMKQLDNSLSTSTDNLN… |
| A0A6G0TJV9 | 7-149 | MVNKTSMVVISGAISNSLDRFKIRKLEGRPLLLPLNEEARPMGETELQVAVREIKRVFRVKTDLRDACLDQLKQSLNSTKNNLTKGY… |
| A0A6G0U8Z3 | 1-188 | None |
| A0A6G0U4P5 | 47-209 | None |
| A0A6G0U3Q2 | 5-195 | None |
| A0A6G0U021 | 837-1023 | None |
| A0A6G0TT57 | 20-207 | None |
| A0A6G0TNJ3 | 285-472 | None |
| J9L7R6 | 105-233 | None |
| A0A6G0Y4U6 | 47-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.