DPCstruct | MC19388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 128 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0SZH9 | 8-136 | KLVAAKPAPADAKGRNREKLVRYLAEQKALVAAHLAGEPFNATRVVTRKDEAGNRTRVEAPRHVRRGWFTDASGGLFFTLRYGAKPL… |
| A0A2A4R131 | 29-176 | MSILSKLTLTATSPREPITPLARKRIKLLNRIEQQISAAEAELRDEQFMEEIKRWVRNEETGDKTLISTERPVRKWWWKNQHGAWMI… |
| A0A2D5PV40 | 17-126 | None |
| A0A6P1GEP1 | 1-121 | None |
| A0A7W5NCG9 | 1-113 | None |
| A0A2M8U7L0 | 1-143 | None |
| A0A2D7C1P5 | 4-134 | None |
| A0A7W6CMZ4 | 2-124 | None |
| A0A197BUJ9 | 37-158 | None |
| A0A5J5I3K2 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.