DPCstruct | MC19380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 274 ± 49 aa |
| Standard deviation of domain lengths | 49.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B3PWL5 | 2-269 | WKAIYFYLHSVQQQEAFLREASYLLEHYNNKWFFIKYWYGGPHLRFRFLNPSDEFLNSFDKLVADFSHQSVAPIISPTVYYSNINFS… |
| A0A5N6MSZ0 | 23-349 | EMSRVMQSNTVYRGAATRPVKQHLSTTLWSILTIEPERKDAGDDIIRHVVAPLSSQLRVGEGGRFRLSRSLESDRRAVLLHLLATDD… |
| A0A841BZ18 | 55-306 | None |
| A0A1V2KQJ5 | 3-353 | None |
| A0A1G7VC72 | 4-217 | None |
| A0A7J0D042 | 4-261 | None |
| A0A1I2C7Q8 | 9-285 | None |
| H1Y1N0 | 2-277 | None |
| A0A387H3C7 | 89-393 | None |
| A0A2G6YVR1 | 4-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.