DPCstruct | MC1938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15880 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151IS30 | 1-71 | MSSPTVNTNVPGLSNNVVEVPNTPVGPNASKDTEYKNPEYFCYHVDSFGEAEVELAKYRLPAPSNSRPFNK |
| A0A6G0T8E7 | 6-92 | VLTKSCLVNSQFRRYVATTEKPKDITSNVKGLSSKVIIANPPPERVRKAAENGPYKNPQYFSYHKNSYFDAEIEMHKYRLPQPSSLK |
| A0A1A9VNF2 | 181-254 | None |
| A0A835CSC4 | 18-100 | None |
| A0A2J7RGX3 | 17-98 | None |
| J9M1L2 | 24-92 | None |
| A0A7R9J496 | 10-95 | None |
| A0A7R9F9R7 | 89-166 | None |
| A0A6J1TE37 | 30-112 | None |
| W8BK07 | 12-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.