DPCstruct | MC19377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 61 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9K2X5 | 2-60 | PEKKKFLLRLDGDLYEALEKWAADDLRSVNAEMEFLLKEAVRKAGRLKDSSNAARPGRE |
| A0A2A9Z6Y6 | 1-47 | MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQKGK |
| A0A5C7W3S2 | 1-53 | None |
| C6Z4V7 | 1-54 | None |
| A0A255PIT3 | 16-83 | None |
| A0A4Q7W8W9 | 1-70 | None |
| A0A4Q8CGZ7 | 36-102 | None |
| A0A179B2K9 | 9-83 | None |
| A0A291SWC6 | 1-58 | None |
| A0A4P7GW20 | 14-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.